General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q2HW60",
        "id": "A0A3Q2HW60_HORSE",
        "source_organism": {
            "taxId": "9796",
            "scientificName": "Equus caballus",
            "fullName": "Equus caballus (Horse)"
        },
        "name": "m7GpppN-mRNA hydrolase",
        "description": [
            "Decapping metalloenzyme that catalyzes the cleavage of the cap structure on mRNAs. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Plays a role in replication-dependent histone mRNA degradation. Has higher activity towards mRNAs that lack a poly(A) tail. Has no activity towards a cap structure lacking an RNA moiety. The presence of a N(6)-methyladenosine methylation at the second transcribed position of mRNAs (N(6),2'-O-dimethyladenosine cap; m6A(m)) provides resistance to DCP2-mediated decapping. Blocks autophagy in nutrient-rich conditions by repressing the expression of ATG-related genes through degradation of their transcripts"
        ],
        "length": 446,
        "sequence": "MHCSCCGSSSWRLNGWRFPAASWTISAEVLGVFFKAPLRIKCRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSAGSTPAKPTVEKLSRTKFRHSQQLFPEGSPGDQWVKHRQPLQQKPYNNHSETSDLLKAKNQSLRGNGRKQYQDSPNQKKRANGVHSQPAKQQNPLMKCEKKLHPRKLQDNFETDAVYDLPCSSEDQFLEHAEGQSVACNGHCKFPFSSRTFLSFKFDHNAIMKILDL",
        "proteome": "UP000002281",
        "gene": "DCP2",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030145",
                "name": "manganese ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0140933",
                "name": "5'-(N(7)-methylguanosine 5'-triphospho)-[mRNA] hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000184",
                "name": "nuclear-transcribed mRNA catabolic process, nonsense-mediated decay",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000290",
                "name": "deadenylation-dependent decapping of nuclear-transcribed mRNA",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6a34304c0443642199915b93850948b84d4fe523",
        "counters": {
            "domain_architectures": 4156,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 2,
                "cathgene3d": 2,
                "smart": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4156
        }
    }
}