General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q1JAI3",
        "id": "A0A3Q1JAI3_ANATE",
        "source_organism": {
            "taxId": "64144",
            "scientificName": "Anabas testudineus",
            "fullName": "Anabas testudineus (Climbing perch)"
        },
        "name": "Uncharacterized protein",
        "description": [
            "Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Is a critical central regulator of gonadal function"
        ],
        "length": 116,
        "sequence": "MRRGLLLVTLFLIMKPRYSHSRCEEPGSRRSTSDQTIGLDNLKRNILKRYSDLDYDSFVGLMGRRNAGKSSYILKREMHDIFVGLMGRRNSEPDNGPWRRDYPERRGIFLNKCRLR",
        "proteome": "UP000265040",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0007217",
                "name": "tachykinin receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "prosite": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}