GET /api/protein/UniProt/A0A3Q1JAI3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3Q1JAI3",
"id": "A0A3Q1JAI3_ANATE",
"source_organism": {
"taxId": "64144",
"scientificName": "Anabas testudineus",
"fullName": "Anabas testudineus (Climbing perch)"
},
"name": "Uncharacterized protein",
"description": [
"Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Is a critical central regulator of gonadal function"
],
"length": 116,
"sequence": "MRRGLLLVTLFLIMKPRYSHSRCEEPGSRRSTSDQTIGLDNLKRNILKRYSDLDYDSFVGLMGRRNAGKSSYILKREMHDIFVGLMGRRNSEPDNGPWRRDYPERRGIFLNKCRLR",
"proteome": "UP000265040",
"gene": null,
"go_terms": [
{
"identifier": "GO:0007217",
"name": "tachykinin receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1
}
}
}