"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3Q1JAI3"	"{'domain_architectures': 0, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'prosite': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1}"	"['Tachykinins are active peptides which excite neurons, evoke behavioral responses, are potent vasodilators and secretagogues, and contract (directly or indirectly) many smooth muscles. Is a critical central regulator of gonadal function']"	""	"[{'identifier': 'GO:0007217', 'name': 'tachykinin receptor signaling pathway', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A3Q1JAI3_ANATE"	""	True	False	False	116	"Uncharacterized protein"	3	"UP000265040"	"MRRGLLLVTLFLIMKPRYSHSRCEEPGSRRSTSDQTIGLDNLKRNILKRYSDLDYDSFVGLMGRRNAGKSSYILKREMHDIFVGLMGRRNSEPDNGPWRRDYPERRGIFLNKCRLR"	"unreviewed"	"{'taxId': '64144', 'scientificName': 'Anabas testudineus', 'fullName': 'Anabas testudineus (Climbing perch)'}"