GET /api/protein/UniProt/A0A3P9CXW6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P9CXW6",
"id": "A0A3P9CXW6_9CICH",
"source_organism": {
"taxId": "106582",
"scientificName": "Maylandia zebra",
"fullName": "Maylandia zebra (zebra mbuna)"
},
"name": "Checkpoint protein",
"description": [
"Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase"
],
"length": 285,
"sequence": "MKFRGKIIDIACLNHFTRVVTTISKLTKMCVLRLTPDNLFFVLSGKVANGGVSMWCELSQANFFDEYQMEGVSSEDNEICLEVTPENLSRALKTVQNAKAVKVKLTKKHCPCLTIAAELPTLSSVSRVVTHDVPVDVIPRRLWHEFKEPSMPDFDVSIYLPPLKTMKNIVDRMKNLSNFLVIEANLNGEMNLKIETDLVSVTTHFRDLGNPPWGDDASQDGGPSQSRDPESMVEARVDIRRLQQFLVGQQVNPSKAMCNIVHQSVLHLILLHEDMSLQYFIPAVA",
"proteome": "UP000265160",
"gene": null,
"go_terms": [
{
"identifier": "GO:0000077",
"name": "DNA damage checkpoint signaling",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030896",
"name": "checkpoint clamp complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005730",
"name": "nucleolus",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e13f25288c22582ba571297bd69358800cef8732",
"counters": {
"domain_architectures": 4393,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"pirsf": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4393
}
}
}