GET /api/protein/UniProt/A0A3P9CXW6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3P9CXW6",
        "id": "A0A3P9CXW6_9CICH",
        "source_organism": {
            "taxId": "106582",
            "scientificName": "Maylandia zebra",
            "fullName": "Maylandia zebra (zebra mbuna)"
        },
        "name": "Checkpoint protein",
        "description": [
            "Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase"
        ],
        "length": 285,
        "sequence": "MKFRGKIIDIACLNHFTRVVTTISKLTKMCVLRLTPDNLFFVLSGKVANGGVSMWCELSQANFFDEYQMEGVSSEDNEICLEVTPENLSRALKTVQNAKAVKVKLTKKHCPCLTIAAELPTLSSVSRVVTHDVPVDVIPRRLWHEFKEPSMPDFDVSIYLPPLKTMKNIVDRMKNLSNFLVIEANLNGEMNLKIETDLVSVTTHFRDLGNPPWGDDASQDGGPSQSRDPESMVEARVDIRRLQQFLVGQQVNPSKAMCNIVHQSVLHLILLHEDMSLQYFIPAVA",
        "proteome": "UP000265160",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0000077",
                "name": "DNA damage checkpoint signaling",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030896",
                "name": "checkpoint clamp complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005730",
                "name": "nucleolus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e13f25288c22582ba571297bd69358800cef8732",
        "counters": {
            "domain_architectures": 4393,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4393
        }
    }
}