"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3P9CXW6"	"{'domain_architectures': 4393, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pfam': 1, 'pirsf': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4393}"	"[""Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-template and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase""]"	""	"[{'identifier': 'GO:0000077', 'name': 'DNA damage checkpoint signaling', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0030896', 'name': 'checkpoint clamp complex', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0005730', 'name': 'nucleolus', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A3P9CXW6_9CICH"	"e13f25288c22582ba571297bd69358800cef8732"	True	False	False	285	"Checkpoint protein"	3	"UP000265160"	"MKFRGKIIDIACLNHFTRVVTTISKLTKMCVLRLTPDNLFFVLSGKVANGGVSMWCELSQANFFDEYQMEGVSSEDNEICLEVTPENLSRALKTVQNAKAVKVKLTKKHCPCLTIAAELPTLSSVSRVVTHDVPVDVIPRRLWHEFKEPSMPDFDVSIYLPPLKTMKNIVDRMKNLSNFLVIEANLNGEMNLKIETDLVSVTTHFRDLGNPPWGDDASQDGGPSQSRDPESMVEARVDIRRLQQFLVGQQVNPSKAMCNIVHQSVLHLILLHEDMSLQYFIPAVA"	"unreviewed"	"{'taxId': '106582', 'scientificName': 'Maylandia zebra', 'fullName': 'Maylandia zebra (zebra mbuna)'}"