GET /api/protein/UniProt/A0A3P8W205/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A3P8W205",
"id": "A0A3P8W205_CYNSE",
"source_organism": {
"taxId": "244447",
"scientificName": "Cynoglossus semilaevis",
"fullName": "Cynoglossus semilaevis (Tongue sole)"
},
"name": "Guanylate cyclase activator 2B",
"description": [
"Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport"
],
"length": 108,
"sequence": "MKTSLVTITVLVLALGWNSEAVEVEENGLVFSLEAVKRLQELTESRGVMGQQSPRLRANSMSLCADPMLPQEFLPLCKQRGAAASLSRLAMVPLDVCEICAFAACTGC",
"proteome": "UP000265120",
"gene": null,
"go_terms": [
{
"identifier": "GO:0030250",
"name": "guanylate cyclase activator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6b742d3feccab30336fefad457847e24740e1f58",
"counters": {
"domain_architectures": 1241,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"prints": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1241
}
}
}