GET /api/protein/UniProt/A0A3P8W205/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3P8W205",
        "id": "A0A3P8W205_CYNSE",
        "source_organism": {
            "taxId": "244447",
            "scientificName": "Cynoglossus semilaevis",
            "fullName": "Cynoglossus semilaevis (Tongue sole)"
        },
        "name": "Guanylate cyclase activator 2B",
        "description": [
            "Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport"
        ],
        "length": 108,
        "sequence": "MKTSLVTITVLVLALGWNSEAVEVEENGLVFSLEAVKRLQELTESRGVMGQQSPRLRANSMSLCADPMLPQEFLPLCKQRGAAASLSRLAMVPLDVCEICAFAACTGC",
        "proteome": "UP000265120",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0030250",
                "name": "guanylate cyclase activator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6b742d3feccab30336fefad457847e24740e1f58",
        "counters": {
            "domain_architectures": 1241,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1241
        }
    }
}