"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3P8W205"	"{'domain_architectures': 1193, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'pirsf': 1, 'pfam': 1, 'prints': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1193}"	"['Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport']"	""	"[{'identifier': 'GO:0030250', 'name': 'guanylate cyclase activator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A3P8W205_CYNSE"	"6b742d3feccab30336fefad457847e24740e1f58"	True	False	108	"Guanylate cyclase activator 2B"	3	"UP000265120"	"MKTSLVTITVLVLALGWNSEAVEVEENGLVFSLEAVKRLQELTESRGVMGQQSPRLRANSMSLCADPMLPQEFLPLCKQRGAAASLSRLAMVPLDVCEICAFAACTGC"	"unreviewed"	"{'taxId': '244447', 'scientificName': 'Cynoglossus semilaevis', 'fullName': 'Cynoglossus semilaevis (Tongue sole)'}"