General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3G6VC01",
        "id": "A0A3G6VC01_9NOSO",
        "source_organism": {
            "taxId": "2490884",
            "scientificName": "Nostoc sp. 'cyanobiont of Peltigera monticola'",
            "fullName": "Nostoc sp. 'cyanobiont of Peltigera monticola'"
        },
        "name": "RuBisCO chaperone RbcX",
        "description": [
            "An RbcL-specific chaperone. The central cleft of the RbcX homodimer (RbcX2) binds the C-terminus of an RbcL monomer, stabilizing the C-terminus and probably preventing its reassociation with chaperonin GroEL-ES. At the same time the peripheral region of RbcX2 binds a second RbcL monomer, bridging the RbcL homodimers in the correct orientation. The RbcX2(2)-bound RbcL dimers then assemble into the RbcL8 core (RbcL8-(RbcX2)8). RbcS binding triggers the release of RbcX2"
        ],
        "length": 135,
        "sequence": "MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLELWLHNFSSGKIQNGESFIEQLLREKPDLALRIMTVREHIAEEIAEFLPEMVRTGIQQANMEQRRQHLERITRIDTSNPSLQPEQQATSDRDLDNLSN",
        "proteome": null,
        "gene": "rbcX",
        "go_terms": [
            {
                "identifier": "GO:0044183",
                "name": "protein folding chaperone",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0110102",
                "name": "ribulose bisphosphate carboxylase complex assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f8237bbd3e2973dcc800fa3c2a03b43c200ebf7c",
        "counters": {
            "domain_architectures": 3905,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3905
        }
    }
}