"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A3G6VC01"	"{'domain_architectures': 3905, 'entries': 9, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'ncbifam': 1, 'pfam': 1, 'hamap': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3905}"	"['An RbcL-specific chaperone. The central cleft of the RbcX homodimer (RbcX2) binds the C-terminus of an RbcL monomer, stabilizing the C-terminus and probably preventing its reassociation with chaperonin GroEL-ES. At the same time the peripheral region of RbcX2 binds a second RbcL monomer, bridging the RbcL homodimers in the correct orientation. The RbcX2(2)-bound RbcL dimers then assemble into the RbcL8 core (RbcL8-(RbcX2)8). RbcS binding triggers the release of RbcX2']"	"rbcX"	"[{'identifier': 'GO:0044183', 'name': 'protein folding chaperone', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0110102', 'name': 'ribulose bisphosphate carboxylase complex assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A3G6VC01_9NOSO"	"f8237bbd3e2973dcc800fa3c2a03b43c200ebf7c"	True	False	False	135	"RuBisCO chaperone RbcX"	3	""	"MNLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLELWLHNFSSGKIQNGESFIEQLLREKPDLALRIMTVREHIAEEIAEFLPEMVRTGIQQANMEQRRQHLERITRIDTSNPSLQPEQQATSDRDLDNLSN"	"unreviewed"	"{'taxId': '2490884', 'scientificName': ""Nostoc sp. 'cyanobiont of Peltigera monticola'"", 'fullName': ""Nostoc sp. 'cyanobiont of Peltigera monticola'""}"