General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A384B960",
        "id": "A0A384B960_BALAC",
        "source_organism": {
            "taxId": "9767",
            "scientificName": "Balaenoptera acutorostrata",
            "fullName": "Balaenoptera acutorostrata (Common minke whale)"
        },
        "name": "Tissue factor pathway inhibitor",
        "description": [
            "Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma"
        ],
        "length": 253,
        "sequence": "MIDAMKKEQIFCVSVCLLLSCASAPLNAVPEEDEEHTNITDAELPPLKLVHSFCALKADDGPCKAMIKRFFFNIHTQQCEEFIYGGCEGNQNRFESLEECKEKCTRDYPKKTRRTKTTLQKEKPDFCFLEEDAGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKDTCEDTLNDFQVDDYRTQLGAVNNDSLTPQPTKVPSFFVTTGRTNDGWKNADHTYQVFLNICIHASIFILRLHRILCIC",
        "proteome": "UP001652580",
        "gene": "TFPI",
        "go_terms": [
            {
                "identifier": "GO:0004867",
                "name": "serine-type endopeptidase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0030414",
                "name": "peptidase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0010466",
                "name": "negative regulation of peptidase activity",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "11460c335ee125c943cebfa6d20b4d8e96495158",
        "counters": {
            "domain_architectures": 3295,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 2,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3295
        }
    }
}