HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A384B960",
"id": "A0A384B960_BALAC",
"source_organism": {
"taxId": "9767",
"scientificName": "Balaenoptera acutorostrata",
"fullName": "Balaenoptera acutorostrata (Common minke whale)"
},
"name": "Tissue factor pathway inhibitor",
"description": [
"Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma"
],
"length": 253,
"sequence": "MIDAMKKEQIFCVSVCLLLSCASAPLNAVPEEDEEHTNITDAELPPLKLVHSFCALKADDGPCKAMIKRFFFNIHTQQCEEFIYGGCEGNQNRFESLEECKEKCTRDYPKKTRRTKTTLQKEKPDFCFLEEDAGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKDTCEDTLNDFQVDDYRTQLGAVNNDSLTPQPTKVPSFFVTTGRTNDGWKNADHTYQVFLNICIHASIFILRLHRILCIC",
"proteome": "UP001652580",
"gene": "TFPI",
"go_terms": [
{
"identifier": "GO:0004867",
"name": "serine-type endopeptidase inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0030414",
"name": "peptidase inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0010466",
"name": "negative regulation of peptidase activity",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "11460c335ee125c943cebfa6d20b4d8e96495158",
"counters": {
"domain_architectures": 3295,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"cathgene3d": 1,
"ssf": 1,
"cdd": 2,
"smart": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"prosite": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3295
}
}
}