General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A384ALV9",
        "id": "A0A384ALV9_BALAC",
        "source_organism": {
            "taxId": "9767",
            "scientificName": "Balaenoptera acutorostrata",
            "fullName": "Balaenoptera acutorostrata (Common minke whale)"
        },
        "name": "ATP synthase subunit C lysine N-methyltransferase",
        "description": [
            "Mitochondrial protein-lysine N-methyltransferase that trimethylates ATP synthase subunit C, ATP5MC1 and ATP5MC2. Trimethylation is required for proper incorporation of the C subunit into the ATP synthase complex and mitochondrial respiration. Promotes chronic pain. Involved in persistent inflammatory and neuropathic pain: methyltransferase activity in the mitochondria of sensory neurons promotes chronic pain via a pathway that depends on the production of reactive oxygen species (ROS) and on the engagement of spinal cord microglia"
        ],
        "length": 220,
        "sequence": "MEGGGTPPETLKEERQSGCVPPTSPEGNSLKKSNWGFLVTGIVGGTLVAVYAVATPFITPALRRICLPFVPATAKQIENVVKMLRCRRGPLVDIGSGDGRIVIAAAKEGFTAVGYELNPWLVWYSRYCARRDGVQASAKFYISDLWKVTFSQYSNVVIFGVPQMMPQLEKKLELELEDEARVIACRFPFPHWTPAQVTGEGIDTVWAYDASSFRRSKKRP",
        "proteome": "UP001652580",
        "gene": "ATPSCKMT",
        "go_terms": [
            {
                "identifier": "GO:0016279",
                "name": "protein-lysine N-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b18ef5454ff10bbd9c5fa27afbd94804aa1a86b5",
        "counters": {
            "domain_architectures": 1383,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1383
        }
    }
}