"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A384ALV9"	"{'domain_architectures': 1247, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'ssf': 1, 'cathgene3d': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1247}"	"['Mitochondrial protein-lysine N-methyltransferase that trimethylates ATP synthase subunit C, ATP5MC1 and ATP5MC2. Trimethylation is required for proper incorporation of the C subunit into the ATP synthase complex and mitochondrial respiration. Promotes chronic pain. Involved in persistent inflammatory and neuropathic pain: methyltransferase activity in the mitochondria of sensory neurons promotes chronic pain via a pathway that depends on the production of reactive oxygen species (ROS) and on the engagement of spinal cord microglia']"	"ATPSCKMT"	"[{'identifier': 'GO:0016279', 'name': 'protein-lysine N-methyltransferase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A384ALV9_BALAC"	"2a7cc63d9858274650c79189887de978e5aa0bda"	True	False	220	"ATP synthase subunit C lysine N-methyltransferase"	3	"UP001652580"	"MEGGGTPPETLKEERQSGCVPPTSPEGNSLKKSNWGFLVTGIVGGTLVAVYAVATPFITPALRRICLPFVPATAKQIENVVKMLRCRRGPLVDIGSGDGRIVIAAAKEGFTAVGYELNPWLVWYSRYCARRDGVQASAKFYISDLWKVTFSQYSNVVIFGVPQMMPQLEKKLELELEDEARVIACRFPFPHWTPAQVTGEGIDTVWAYDASSFRRSKKRP"	"unreviewed"	"{'taxId': '9767', 'scientificName': 'Balaenoptera acutorostrata', 'fullName': 'Balaenoptera acutorostrata (Common minke whale)'}"