General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A384AI61",
        "id": "A0A384AI61_BALAC",
        "source_organism": {
            "taxId": "9767",
            "scientificName": "Balaenoptera acutorostrata",
            "fullName": "Balaenoptera acutorostrata (Common minke whale)"
        },
        "name": "DAZ-associated protein 2",
        "description": [
            "In unstressed cells, promotes SIAH1-mediated polyubiquitination and degradation of the serine/threonine-protein kinase HIPK2, probably by acting as a loading factor that potentiates complex formation between HIPK2 and ubiquitin ligase SIAH1. In response to DNA damage, localizes to the nucleus following phosphorylation by HIPK2 and modulates the expression of a subset of TP53/p53 target genes by binding to TP53 at target gene promoters. This limits the expression of a number of cell death-mediating TP53 target genes, reducing DNA damage-induced cell death. Enhances the binding of transcription factor TCF7L2/TCF4, a Wnt signaling pathway effector, to the promoters of target genes. Plays a role in stress granule formation"
        ],
        "length": 86,
        "sequence": "MNGRGQYPPQPAYPAQPPGNPVCPQTLHLPQVPPCTDASPACSEVCPTGYPPSTAQLAVMQGAHVLVTQWKRNFSVGGSDGDYTIR",
        "proteome": "UP001652580",
        "gene": "LOC103000206",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1c6c9e1140f1ba396a396ba6f8295378c7aaad0f",
        "counters": {
            "domain_architectures": 1542,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1542
        }
    }
}