"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A384AI61"	"{'domain_architectures': 1542, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1542}"	"['In unstressed cells, promotes SIAH1-mediated polyubiquitination and degradation of the serine/threonine-protein kinase HIPK2, probably by acting as a loading factor that potentiates complex formation between HIPK2 and ubiquitin ligase SIAH1. In response to DNA damage, localizes to the nucleus following phosphorylation by HIPK2 and modulates the expression of a subset of TP53/p53 target genes by binding to TP53 at target gene promoters. This limits the expression of a number of cell death-mediating TP53 target genes, reducing DNA damage-induced cell death. Enhances the binding of transcription factor TCF7L2/TCF4, a Wnt signaling pathway effector, to the promoters of target genes. Plays a role in stress granule formation']"	"LOC103000206"	""	"A0A384AI61_BALAC"	"1c6c9e1140f1ba396a396ba6f8295378c7aaad0f"	True	False	False	86	"DAZ-associated protein 2"	4	"UP001652580"	"MNGRGQYPPQPAYPAQPPGNPVCPQTLHLPQVPPCTDASPACSEVCPTGYPPSTAQLAVMQGAHVLVTQWKRNFSVGGSDGDYTIR"	"unreviewed"	"{'taxId': '9767', 'scientificName': 'Balaenoptera acutorostrata', 'fullName': 'Balaenoptera acutorostrata (Common minke whale)'}"