General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A379BUT7",
        "id": "A0A379BUT7_PEDPE",
        "source_organism": {
            "taxId": "1255",
            "scientificName": "Pediococcus pentosaceus",
            "fullName": "Pediococcus pentosaceus"
        },
        "name": "Probable DNA-directed RNA polymerase subunit delta",
        "description": [
            "Participates in both the initiation and recycling phases of transcription. In the presence of the delta subunit, RNAP displays an increased specificity of transcription, a decreased affinity for nucleic acids, and an increased efficiency of RNA synthesis because of enhanced recycling"
        ],
        "length": 178,
        "sequence": "MELENFKGQNKNELSMIEVAHAILAKSGEPMAFVDLANAVQSYLDKTDEEFRNRLSQFYTDLNVDGSFISLGENTWGLRTWYPFESIDEALIHAEDEDEDRPVRKKRKKVNAFLADAADDDDVIDYDSDDPEDEEVEAEDTTSDDAPAFEDLSNDDDTDVLPDGIEGQLSELNEDDEN",
        "proteome": "UP000472573",
        "gene": "rpoE",
        "go_terms": [
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "51850a739586678193aa510fe3f7e236dc6def99",
        "counters": {
            "domain_architectures": 4316,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4316
        }
    }
}