GET /api/protein/UniProt/A0A379BUT7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A379BUT7",
"id": "A0A379BUT7_PEDPE",
"source_organism": {
"taxId": "1255",
"scientificName": "Pediococcus pentosaceus",
"fullName": "Pediococcus pentosaceus"
},
"name": "Probable DNA-directed RNA polymerase subunit delta",
"description": [
"Participates in both the initiation and recycling phases of transcription. In the presence of the delta subunit, RNAP displays an increased specificity of transcription, a decreased affinity for nucleic acids, and an increased efficiency of RNA synthesis because of enhanced recycling"
],
"length": 178,
"sequence": "MELENFKGQNKNELSMIEVAHAILAKSGEPMAFVDLANAVQSYLDKTDEEFRNRLSQFYTDLNVDGSFISLGENTWGLRTWYPFESIDEALIHAEDEDEDRPVRKKRKKVNAFLADAADDDDVIDYDSDDPEDEEVEAEDTTSDDAPAFEDLSNDDDTDVLPDGIEGQLSELNEDDEN",
"proteome": "UP000472573",
"gene": "rpoE",
"go_terms": [
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "51850a739586678193aa510fe3f7e236dc6def99",
"counters": {
"domain_architectures": 4316,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"hamap": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4316
}
}
}