"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A379BUT7"	"{'domain_architectures': 4316, 'entries': 8, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'hamap': 1, 'ncbifam': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4316}"	"['Participates in both the initiation and recycling phases of transcription. In the presence of the delta subunit, RNAP displays an increased specificity of transcription, a decreased affinity for nucleic acids, and an increased efficiency of RNA synthesis because of enhanced recycling']"	"rpoE"	"[{'identifier': 'GO:0006355', 'name': 'regulation of DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006351', 'name': 'DNA-templated transcription', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"A0A379BUT7_PEDPE"	"51850a739586678193aa510fe3f7e236dc6def99"	True	False	False	178	"Probable DNA-directed RNA polymerase subunit delta"	3	"UP000472573"	"MELENFKGQNKNELSMIEVAHAILAKSGEPMAFVDLANAVQSYLDKTDEEFRNRLSQFYTDLNVDGSFISLGENTWGLRTWYPFESIDEALIHAEDEDEDRPVRKKRKKVNAFLADAADDDDVIDYDSDDPEDEEVEAEDTTSDDAPAFEDLSNDDDTDVLPDGIEGQLSELNEDDEN"	"unreviewed"	"{'taxId': '1255', 'scientificName': 'Pediococcus pentosaceus', 'fullName': 'Pediococcus pentosaceus'}"
