GET /api/protein/UniProt/A0A2Y9ESY9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2Y9ESY9",
        "id": "A0A2Y9ESY9_PHYMC",
        "source_organism": {
            "taxId": "9755",
            "scientificName": "Physeter macrocephalus",
            "fullName": "Physeter macrocephalus (Sperm whale)"
        },
        "name": "Docking protein 1",
        "description": [
            "DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK1 appears to be a negative regulator of the insulin signaling pathway. Modulates integrin activation by competing with talin for the same binding site on ITGB3"
        ],
        "length": 481,
        "sequence": "MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGSSRRLDCKVIRLAECVSVAPVAVESPPEPGAAAFRLDTAQRSHLLAADAPSSAAWVQTLCRNAFPKGSWALAPAENPPKLSALEMLENSLYSPAWEGSQFWVTVQRTEAAERCGLHGSYMLRVEAERLTLLGVGAQSQIQEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQGKASQGQDVLRADSHEGEVAEGKLAPHRGPQELAGSTPALYAEPLDSLRILPGPSQDSVYSDPLDSTPAQAGEGLKKPLYWDLCEHVQQQLIKAKLTDPKEDPIYDEPEGLAPAALRGLYDLPQEPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRCTKPFPAPKPQGLAFSESGAAAGSGSKGHSSDAALYSQVQKSGASGSWDCGLSGAGTDRTGAKSEGST",
        "proteome": "UP000248484",
        "gene": "DOK1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c8a40e550b300634ec01479500bc4ee8471809d5",
        "counters": {
            "domain_architectures": 4665,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 3,
                "pfam": 2,
                "cdd": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4665
        }
    }
}