GET /api/protein/UniProt/A0A2Y9ESY9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2Y9ESY9",
"id": "A0A2Y9ESY9_PHYMC",
"source_organism": {
"taxId": "9755",
"scientificName": "Physeter macrocephalus",
"fullName": "Physeter macrocephalus (Sperm whale)"
},
"name": "Docking protein 1",
"description": [
"DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK1 appears to be a negative regulator of the insulin signaling pathway. Modulates integrin activation by competing with talin for the same binding site on ITGB3"
],
"length": 481,
"sequence": "MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKGSSSGGGRGSSRRLDCKVIRLAECVSVAPVAVESPPEPGAAAFRLDTAQRSHLLAADAPSSAAWVQTLCRNAFPKGSWALAPAENPPKLSALEMLENSLYSPAWEGSQFWVTVQRTEAAERCGLHGSYMLRVEAERLTLLGVGAQSQIQEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDIFQAVETAIHRQKAQGKASQGQDVLRADSHEGEVAEGKLAPHRGPQELAGSTPALYAEPLDSLRILPGPSQDSVYSDPLDSTPAQAGEGLKKPLYWDLCEHVQQQLIKAKLTDPKEDPIYDEPEGLAPAALRGLYDLPQEPKDAWWCQARVKEEGYELPYNPATDDYAVPPPRCTKPFPAPKPQGLAFSESGAAAGSGSKGHSSDAALYSQVQKSGASGSWDCGLSGAGTDRTGAKSEGST",
"proteome": "UP000248484",
"gene": "DOK1",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c8a40e550b300634ec01479500bc4ee8471809d5",
"counters": {
"domain_architectures": 4665,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 3,
"pfam": 2,
"cdd": 1,
"profile": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4665
}
}
}