GET /api/protein/UniProt/A0A2W5RTY6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2W5RTY6",
"id": "A0A2W5RTY6_ACIJO",
"source_organism": {
"taxId": "40214",
"scientificName": "Acinetobacter johnsonii",
"fullName": "Acinetobacter johnsonii"
},
"name": "Type II secretion system protein I",
"description": [
"Component of the type II secretion system required for the energy-dependent secretion of extracellular factors such as proteases and toxins from the periplasm"
],
"length": 133,
"sequence": "MKCHLINPRSGFTLLEVMVALAIFATAAVALTKVGMQYTQSTAHAILRTKAQFVALNEISMMEINRDWLQGKASKQITQQGETWQIDKSAQATISANVQRVNVQVSLVNTETGKVDSGVTSLVFFNHRDGSQP",
"proteome": null,
"gene": "gspI",
"go_terms": [
{
"identifier": "GO:0015628",
"name": "protein secretion by the type II secretion system",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0015627",
"name": "type II protein secretion system complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5fb6e4e66bf5a3e4cfda5aeca3f4e668bd4b5a86",
"counters": {
"domain_architectures": 4428,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"ncbifam": 2,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4428
}
}
}