"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2W5RTY6"	"{'domain_architectures': 4428, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'ncbifam': 2, 'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 4428}"	"['Component of the type II secretion system required for the energy-dependent secretion of extracellular factors such as proteases and toxins from the periplasm']"	"gspI"	"[{'identifier': 'GO:0015628', 'name': 'protein secretion by the type II secretion system', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0015627', 'name': 'type II protein secretion system complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A2W5RTY6_ACIJO"	"5fb6e4e66bf5a3e4cfda5aeca3f4e668bd4b5a86"	True	False	False	133	"Type II secretion system protein I"	3	""	"MKCHLINPRSGFTLLEVMVALAIFATAAVALTKVGMQYTQSTAHAILRTKAQFVALNEISMMEINRDWLQGKASKQITQQGETWQIDKSAQATISANVQRVNVQVSLVNTETGKVDSGVTSLVFFNHRDGSQP"	"unreviewed"	"{'taxId': '40214', 'scientificName': 'Acinetobacter johnsonii', 'fullName': 'Acinetobacter johnsonii'}"