GET /api/protein/UniProt/A0A2T5LPL2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2T5LPL2",
"id": "A0A2T5LPL2_9EURO",
"source_organism": {
"taxId": "1392256",
"scientificName": "Aspergillus ochraceoroseus IBT 24754",
"fullName": "Aspergillus ochraceoroseus IBT 24754"
},
"name": "NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1",
"description": [
"Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone"
],
"length": 86,
"sequence": "MGVPFEALIPYGIIVGMFGVTGVGLTVAKYIANDGKKARWNKDLWDRVMMERDLRITGSLRGQSTNPEAPKGFELSNPWKLEKRIY",
"proteome": null,
"gene": "P175DRAFT_0511657",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fcb07398d624f23d2367718ffaa4d361ab152637",
"counters": {
"domain_architectures": 3015,
"entries": 3,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3015
}
}
}