"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2T5LPL2"	"{'domain_architectures': 3015, 'entries': 3, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3015}"	"['Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone']"	"P175DRAFT_0511657"	""	"A0A2T5LPL2_9EURO"	"fcb07398d624f23d2367718ffaa4d361ab152637"	True	False	False	86	"NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1"	3	""	"MGVPFEALIPYGIIVGMFGVTGVGLTVAKYIANDGKKARWNKDLWDRVMMERDLRITGSLRGQSTNPEAPKGFELSNPWKLEKRIY"	"unreviewed"	"{'taxId': '1392256', 'scientificName': 'Aspergillus ochraceoroseus IBT 24754', 'fullName': 'Aspergillus ochraceoroseus IBT 24754'}"