HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K6GV81",
"id": "A0A2K6GV81_PROCO",
"source_organism": {
"taxId": "379532",
"scientificName": "Propithecus coquereli",
"fullName": "Propithecus coquereli (Coquerel's sifaka)"
},
"name": "Cytotoxic T-lymphocyte protein 4",
"description": [
"Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28"
],
"length": 174,
"sequence": "MACLGFQRHKAQLDLASRTWSCMALFSLLFIPVFTKAMHVAQPEVVLASNRGVANFMCEYESSGKATEIRVTVLRQANSQETEVCAATYMVEEELTFLDDSTCVGTSSGNKVNLTIQGLRAKDMGLYICKVELMYPPPYYVGVGNGTQIYVIAKEKKPSYNRGLCENAPNRARM",
"proteome": "UP000233160",
"gene": "CTLA4",
"go_terms": [
{
"identifier": "GO:0042129",
"name": "regulation of T cell proliferation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006955",
"name": "immune response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5ed7c00baee6d5d5484012bbe9c8560ea78da669",
"counters": {
"domain_architectures": 138160,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"smart": 2,
"panther": 1,
"prints": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 138160
}
}
}