GET /api/protein/UniProt/A0A2K6GV81/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K6GV81",
        "id": "A0A2K6GV81_PROCO",
        "source_organism": {
            "taxId": "379532",
            "scientificName": "Propithecus coquereli",
            "fullName": "Propithecus coquereli (Coquerel's sifaka)"
        },
        "name": "Cytotoxic T-lymphocyte protein 4",
        "description": [
            "Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28"
        ],
        "length": 174,
        "sequence": "MACLGFQRHKAQLDLASRTWSCMALFSLLFIPVFTKAMHVAQPEVVLASNRGVANFMCEYESSGKATEIRVTVLRQANSQETEVCAATYMVEEELTFLDDSTCVGTSSGNKVNLTIQGLRAKDMGLYICKVELMYPPPYYVGVGNGTQIYVIAKEKKPSYNRGLCENAPNRARM",
        "proteome": "UP000233160",
        "gene": "CTLA4",
        "go_terms": [
            {
                "identifier": "GO:0042129",
                "name": "regulation of T cell proliferation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006955",
                "name": "immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5ed7c00baee6d5d5484012bbe9c8560ea78da669",
        "counters": {
            "domain_architectures": 138160,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "smart": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 138160
        }
    }
}