"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2K6GV81"	"{'domain_architectures': 127517, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'smart': 2, 'panther': 1, 'prints': 1, 'interpro': 7}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 127517}"	"['Inhibitory receptor acting as a major negative regulator of T-cell responses. Acts as a decoy receptor: the affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28']"	""	"[{'identifier': 'GO:0042129', 'name': 'regulation of T cell proliferation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006955', 'name': 'immune response', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A2K6GV81_PROCO"	"5ed7c00baee6d5d5484012bbe9c8560ea78da669"	True	False	174	"Cytotoxic T-lymphocyte protein 4"	4	"UP000233160"	"MACLGFQRHKAQLDLASRTWSCMALFSLLFIPVFTKAMHVAQPEVVLASNRGVANFMCEYESSGKATEIRVTVLRQANSQETEVCAATYMVEEELTFLDDSTCVGTSSGNKVNLTIQGLRAKDMGLYICKVELMYPPPYYVGVGNGTQIYVIAKEKKPSYNRGLCENAPNRARM"	"unreviewed"	"{'taxId': '379532', 'scientificName': 'Propithecus coquereli', 'fullName': ""Propithecus coquereli (Coquerel's sifaka)""}"