GET /api/protein/UniProt/A0A2K5YP72/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K5YP72",
        "id": "A0A2K5YP72_MANLE",
        "source_organism": {
            "taxId": "9568",
            "scientificName": "Mandrillus leucophaeus",
            "fullName": "Mandrillus leucophaeus (Drill)"
        },
        "name": "Methyl-CpG-binding protein 2",
        "description": [
            "Chromosomal protein that binds to methylated DNA. It can bind specifically to a single methyl-CpG pair. It is not influenced by sequences flanking the methyl-CpGs. Mediates transcriptional repression through interaction with histone deacetylase and the corepressor SIN3A. Binds both 5-methylcytosine (5mC) and 5-hydroxymethylcytosine (5hmC)-containing DNA, with a preference for 5-methylcytosine (5mC)"
        ],
        "length": 162,
        "sequence": "MLGREEKSEDQDLQGLKDKPLKFKKVKKDKKEDKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTPLPARAETT",
        "proteome": "UP000233140",
        "gene": "MECP2",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "420b60b3d20e41aa507c13c8bee752dc6e1581ae",
        "counters": {
            "domain_architectures": 6111,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "smart": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6111
        }
    }
}