"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2K5YP72"	"{'domain_architectures': 6111, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'smart': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 6111}"	"['Chromosomal protein that binds to methylated DNA. It can bind specifically to a single methyl-CpG pair. It is not influenced by sequences flanking the methyl-CpGs. Mediates transcriptional repression through interaction with histone deacetylase and the corepressor SIN3A. Binds both 5-methylcytosine (5mC) and 5-hydroxymethylcytosine (5hmC)-containing DNA, with a preference for 5-methylcytosine (5mC)']"	"MECP2"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A2K5YP72_MANLE"	"420b60b3d20e41aa507c13c8bee752dc6e1581ae"	True	False	False	162	"Methyl-CpG-binding protein 2"	4	"UP000233140"	"MLGREEKSEDQDLQGLKDKPLKFKKVKKDKKEDKEGKHEPVQPSAHHSAEPAEAGKAETSEGSGSAPAVPEASASPKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTPLPARAETT"	"unreviewed"	"{'taxId': '9568', 'scientificName': 'Mandrillus leucophaeus', 'fullName': 'Mandrillus leucophaeus (Drill)'}"