GET /api/protein/UniProt/A0A2K5PAV0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K5PAV0",
        "id": "A0A2K5PAV0_CEBIM",
        "source_organism": {
            "taxId": "2715852",
            "scientificName": "Cebus imitator",
            "fullName": "Cebus imitator (Panamanian white-faced capuchin)"
        },
        "name": "Mitochondrial import inner membrane translocase subunit TIM14",
        "description": [
            "Mitochondrial co-chaperone which forms a complex with prohibitins to regulate cardiolipin remodeling. May be a component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity"
        ],
        "length": 116,
        "sequence": "MASTMVAVGLTIAAAGFAGRYVLQAMKHMEPHVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRLMLLNHPDKGGSPYIAAKINEANDLLEGQAKK",
        "proteome": "UP000233040",
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "500088c3adc88e8af670fe08554083396acf46f3",
        "counters": {
            "domain_architectures": 98256,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 98256
        }
    }
}