GET /api/protein/UniProt/A0A2K5PAV0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2K5PAV0",
"id": "A0A2K5PAV0_CEBIM",
"source_organism": {
"taxId": "2715852",
"scientificName": "Cebus imitator",
"fullName": "Cebus imitator (Panamanian white-faced capuchin)"
},
"name": "Mitochondrial import inner membrane translocase subunit TIM14",
"description": [
"Mitochondrial co-chaperone which forms a complex with prohibitins to regulate cardiolipin remodeling. May be a component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity"
],
"length": 116,
"sequence": "MASTMVAVGLTIAAAGFAGRYVLQAMKHMEPHVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRLMLLNHPDKGGSPYIAAKINEANDLLEGQAKK",
"proteome": "UP000233040",
"gene": null,
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "500088c3adc88e8af670fe08554083396acf46f3",
"counters": {
"domain_architectures": 98256,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 98256
}
}
}