"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2K5PAV0"	"{'domain_architectures': 98256, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'smart': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 98256}"	"['Mitochondrial co-chaperone which forms a complex with prohibitins to regulate cardiolipin remodeling. May be a component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity']"	""	""	"A0A2K5PAV0_CEBIM"	"500088c3adc88e8af670fe08554083396acf46f3"	True	False	False	116	"Mitochondrial import inner membrane translocase subunit TIM14"	3	"UP000233040"	"MASTMVAVGLTIAAAGFAGRYVLQAMKHMEPHVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRLMLLNHPDKGGSPYIAAKINEANDLLEGQAKK"	"unreviewed"	"{'taxId': '2715852', 'scientificName': 'Cebus imitator', 'fullName': 'Cebus imitator (Panamanian white-faced capuchin)'}"
