GET /api/protein/UniProt/A0A2K5M2V3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2K5M2V3",
        "id": "A0A2K5M2V3_CERAT",
        "source_organism": {
            "taxId": "9531",
            "scientificName": "Cercocebus atys",
            "fullName": "Cercocebus atys (Sooty mangabey)"
        },
        "name": "Thioredoxin domain-containing protein 8",
        "description": [
            "May be required for post-translational modifications of proteins required for acrosomal biogenesis. May act by reducing disulfide bonds within the sperm"
        ],
        "length": 114,
        "sequence": "MVQIINDMNEFKTFLTAAGHKLAVVEFSSKWCGPCKRMVPVFHAMSVKYQNVFFANVDVNNSPELAETCHIKTIPTFQMFKKSQKVTLFSRIKRIICCYRSEFMSNPCPANDGN",
        "proteome": "UP000233060",
        "gene": "TXNDC8",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c184e98bae53a420073bcaa179da7ca963727ccd",
        "counters": {
            "domain_architectures": 119874,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 119874
        }
    }
}