"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2K5M2V3"	"{'domain_architectures': 119874, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'profile': 1, 'ssf': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 119874}"	"['May be required for post-translational modifications of proteins required for acrosomal biogenesis. May act by reducing disulfide bonds within the sperm']"	"TXNDC8"	""	"A0A2K5M2V3_CERAT"	"c184e98bae53a420073bcaa179da7ca963727ccd"	True	False	False	114	"Thioredoxin domain-containing protein 8"	3	"UP000233060"	"MVQIINDMNEFKTFLTAAGHKLAVVEFSSKWCGPCKRMVPVFHAMSVKYQNVFFANVDVNNSPELAETCHIKTIPTFQMFKKSQKVTLFSRIKRIICCYRSEFMSNPCPANDGN"	"unreviewed"	"{'taxId': '9531', 'scientificName': 'Cercocebus atys', 'fullName': 'Cercocebus atys (Sooty mangabey)'}"