General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2I4CKS2",
        "id": "A0A2I4CKS2_AUSLI",
        "source_organism": {
            "taxId": "52670",
            "scientificName": "Austrofundulus limnaeus",
            "fullName": "Austrofundulus limnaeus (Annual killifish)"
        },
        "name": "Transforming growth factor beta-1 proprotein",
        "description": [
            "Required to maintain the Transforming growth factor beta-1 (TGF-beta-1) chain in a latent state during storage in extracellular matrix. Associates non-covalently with TGF-beta-1 and regulates its activation via interaction with 'milieu molecules', such as LTBP1, LRRC32/GARP and LRRC33/NRROS, that control activation of TGF-beta-1. Interaction with integrins (ITGAV:ITGB6 or ITGAV:ITGB8) results in distortion of the Latency-associated peptide chain and subsequent release of the active TGF-beta-1",
            "Transforming growth factor beta-1 proprotein: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-1 (TGF-beta-1) chains, which constitute the regulatory and active subunit of TGF-beta-1, respectively"
        ],
        "length": 474,
        "sequence": "MDLRVKAVAMRFGFVLLVAAQMLDTMSGMSTCKTLDQEIVRQKRIEAIRSQILSKLRLPKAPEANETGDKEEIPTSLLSLYNSTKDMLKEQQIEVQSTISPEQEEEEYFAKVLNKFNMTTTNLTDSSKIMFFNMSEVRRSVGDAALLTSAELRMLIKNTRVREEQRVELYYSSGGSPRYHASRFITNSMKEKWLSFDVTEPLQHWLQQTEEEQSFQLRVFCECGQPGSIFSFSISGTDHIRGDTATMRQRSEQPPYVLTMSIPQNMSARFITNSMKEKWLSFDVTEPLQHWLQQTEEEQSFQLRVFCECGQPGSIFSFSISGTDHIRGDTATMRQRSEQPPYVLTMSIPQNMSARLTSRTKRSTAAQETCTAQTETCCVRSLYIDFRKDLGWKWIHKPTGYHANYCMGSCTYIWNAENKYSQIMALYKHHNPGASAQPCCVPQALEPLPILYYVGRQHRVDQLSNMIVKSCRCG",
        "proteome": "UP000192220",
        "gene": "tgfb1a",
        "go_terms": [
            {
                "identifier": "GO:0008083",
                "name": "growth factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005615",
                "name": "extracellular space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005160",
                "name": "transforming growth factor beta receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3cbb0d77e515dc60d80b6c4a91c3c776025269b4",
        "counters": {
            "domain_architectures": 116,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 2,
                "smart": 1,
                "pirsf": 1,
                "panther": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 116
        }
    }
}