GET /api/protein/UniProt/A0A2I3SKP0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2I3SKP0",
"id": "A0A2I3SKP0_PANTR",
"source_organism": {
"taxId": "9598",
"scientificName": "Pan troglodytes",
"fullName": "Pan troglodytes (Chimpanzee)"
},
"name": "Zinc finger CCCH domain-containing protein 14",
"description": [
"RNA-binding protein involved in the biogenesis of circular RNAs (circRNAs), which are produced by back-splicing circularization of pre-mRNAs. Acts by binding to both exon-intron boundary and 3'-UTR of pre-mRNAs to promote circRNA biogenesis through dimerization and the association with the spliceosome. Required for spermatogenesis via involvement in circRNA biogenesis. Regulates the pre-mRNA processing of ATP5MC1; preventing its degradation. Also binds the poly(A) tail of mRNAs; controlling poly(A) length in neuronal cells"
],
"length": 282,
"sequence": "MRMSSKFPSPPLPIFLPPEPVDLGSITSSSCSLNEPDNISHRLRKISADINEIKGMRAAILTVEANLFDLNVRVSKNEAKISSLEVKMNEYSTTYECNRQFEDQEEDTESQSRTTDVKIIGFLRNVEKAEMSELSVAQKPEKLLERCKYWPACKNGDECAYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLSPKPAVAPPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE",
"proteome": "UP000002277",
"gene": "ZC3H14",
"go_terms": [
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008143",
"name": "poly(A) binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0043488",
"name": "regulation of mRNA stability",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a972a1612e2e69965f45f9d830c28aa07f99643a",
"counters": {
"domain_architectures": 1960,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"smart": 1,
"cathgene3d": 2,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1960
}
}
}