GET /api/protein/UniProt/A0A2D2ALR9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2D2ALR9",
        "id": "A0A2D2ALR9_9PAPI",
        "source_organism": {
            "taxId": "1513258",
            "scientificName": "Gammapapillomavirus 13",
            "fullName": "Gammapapillomavirus 13"
        },
        "name": "Protein E6",
        "description": [
            "Plays a major role in the induction and maintenance of cellular transformation. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase and modulates its activity. Protects host keratinocytes from apoptosis by mediating the degradation of host BAK1. May also inhibit host immune response"
        ],
        "length": 144,
        "sequence": "METTGPTRLDEFCQVSGINFFDLQLPCVFCKFICTVEDLASFFKKNLSIVYRSTVPFACCIKCLKHTALYERQRFSLCCVKPSVIDVLTGKSFFELPVRCLFCLSLLDPIERREACLRNDDVILVRGHWRCICRVCFAFQYEVE",
        "proteome": null,
        "gene": "E6",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "730136671aace6ff6b5909f8760c6baaab2b52a2",
        "counters": {
            "domain_architectures": 3542,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3542
        }
    }
}