GET /api/protein/UniProt/A0A2D2ALR9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A2D2ALR9",
"id": "A0A2D2ALR9_9PAPI",
"source_organism": {
"taxId": "1513258",
"scientificName": "Gammapapillomavirus 13",
"fullName": "Gammapapillomavirus 13"
},
"name": "Protein E6",
"description": [
"Plays a major role in the induction and maintenance of cellular transformation. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase and modulates its activity. Protects host keratinocytes from apoptosis by mediating the degradation of host BAK1. May also inhibit host immune response"
],
"length": 144,
"sequence": "METTGPTRLDEFCQVSGINFFDLQLPCVFCKFICTVEDLASFFKKNLSIVYRSTVPFACCIKCLKHTALYERQRFSLCCVKPSVIDVLTGKSFFELPVRCLFCLSLLDPIERREACLRNDDVILVRGHWRCICRVCFAFQYEVE",
"proteome": null,
"gene": "E6",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "730136671aace6ff6b5909f8760c6baaab2b52a2",
"counters": {
"domain_architectures": 3542,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"hamap": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3542
}
}
}