"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A2D2ALR9"	"{'domain_architectures': 3542, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'hamap': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3542}"	"['Plays a major role in the induction and maintenance of cellular transformation. E6 associates with host UBE3A/E6-AP ubiquitin-protein ligase and modulates its activity. Protects host keratinocytes from apoptosis by mediating the degradation of host BAK1. May also inhibit host immune response']"	"E6"	""	"A0A2D2ALR9_9PAPI"	"730136671aace6ff6b5909f8760c6baaab2b52a2"	False	False	False	144	"Protein E6"	3	""	"METTGPTRLDEFCQVSGINFFDLQLPCVFCKFICTVEDLASFFKKNLSIVYRSTVPFACCIKCLKHTALYERQRFSLCCVKPSVIDVLTGKSFFELPVRCLFCLSLLDPIERREACLRNDDVILVRGHWRCICRVCFAFQYEVE"	"unreviewed"	"{'taxId': '1513258', 'scientificName': 'Gammapapillomavirus 13', 'fullName': 'Gammapapillomavirus 13'}"