General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A2D0RGN8",
        "id": "A0A2D0RGN8_ICTPU",
        "source_organism": {
            "taxId": "7998",
            "scientificName": "Ictalurus punctatus",
            "fullName": "Ictalurus punctatus (Channel catfish)"
        },
        "name": "S-adenosylmethionine sensor upstream of mTORC1",
        "description": [
            "S-adenosyl-L-methionine-binding protein that acts as an inhibitor of mTORC1 signaling via interaction with the GATOR1 and KICSTOR complexes. Acts as a sensor of S-adenosyl-L-methionine to signal methionine sufficiency to mTORC1: in presence of methionine, binds S-adenosyl-L-methionine, leading to disrupt interaction with the GATOR1 and KICSTOR complexes and promote mTORC1 signaling. Upon methionine starvation, S-adenosyl-L-methionine levels are reduced, thereby promoting the association with GATOR1 and KICSTOR, leading to inhibit mTORC1 signaling. Probably also acts as a S-adenosyl-L-methionine-dependent methyltransferase"
        ],
        "length": 407,
        "sequence": "MRHSRIPVVRELQQHGHYSVSAMELQPSVRTEPEPGMFHSAGRRDALCERDEQEKLSGVVKRVHRKLRRKYIEVGDFDKIWREHCEDEQTLNEYAFAMKSLADNHWAKKCDGEGRIEWCRSVCQEYFMDGGMKKMLEKDAKHAAAASGTPLNPDSSQPSLSFRNDKLRLLDVGSCFNPFLKFDEFFTVGIDIVPAVESVYKCDFLNLQLQQPLQLASDALNAFLRQLHDPIETLPGQLFHVVVFSLLLSYFPSPYQRWLCCKKAHELLTLHGLLLIITPDSSHQGRHALMMRSWRVAVESLGFRRYKYVKFSHMHMLAFRKVSVTTSSDLVSHNYPEMLYIPQDFGTLEEDDAFRDSYQPARSDSEDEQLARSFTELPDVSYDSDSGESQSGSAPFYELEDPILLYS",
        "proteome": "UP000221080",
        "gene": "bmt2",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}