GET /api/protein/UniProt/A0A287AGF8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A287AGF8",
        "id": "A0A287AGF8_PIG",
        "source_organism": {
            "taxId": "9823",
            "scientificName": "Sus scrofa",
            "fullName": "Sus scrofa (Pig)"
        },
        "name": "Elongation of very long chain fatty acids protein 2",
        "description": [
            "Catalyzes the first and rate-limiting reaction of the four reactions that constitute the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. Acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C20:4(n-6) acyl-CoA. Condensing enzyme that catalyzes the synthesis of polyunsaturated very long chain fatty acid (C20- and C22-PUFA). May participate to the production of polyunsaturated VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators"
        ],
        "length": 318,
        "sequence": "GLSPFSGERLSLSRSWSSFVYIHEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFVLTVLYLLSIWLGNRFMKSRPALSLRGLLTFYNLGITLLSAYMLAELILSSWEGGYNLQCQDLTSAGEADIRVARVLWWYYFSKLIEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLWWKRYLTQAQLVQFVLTITHTLSAVVRPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDTDAPPAGKEVKNGFSKVYFTATNGAINKKAQ",
        "proteome": "UP000008227",
        "gene": "ELOVL2",
        "go_terms": [
            {
                "identifier": "GO:0009922",
                "name": "fatty acid elongase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019367",
                "name": "fatty acid elongation, saturated fatty acid",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042761",
                "name": "very long-chain fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005783",
                "name": "endoplasmic reticulum",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "726b44df556ad17af08cf1eeb76a7efce6e198bf",
        "counters": {
            "domain_architectures": 25966,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25966
        }
    }
}