General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A218U8V2",
        "id": "A0A218U8V2_9PASE",
        "source_organism": {
            "taxId": "40157",
            "scientificName": "Lonchura striata",
            "fullName": "Lonchura striata (white-rumped munia)"
        },
        "name": "Lysophospholipase-like protein 1",
        "description": [
            "Palmitoyl thioesterase that catalyzes depalmitoylation of CGAS and KCNMA1. Acts as a regulator of innate immunity by mediating depalmitoylation of CGAS, thereby preventing CGAS homodimerization and cyclic GMP-AMP synthase activity. Does not exhibit phospholipase nor triacylglycerol lipase activity, able to hydrolyze only short chain substrates due to its shallow active site"
        ],
        "length": 236,
        "sequence": "MAAPAALQRSVVSPAGRHTASLIFLHGSGDTGQGARAWIKQILNQDMAFQHIKVIYPTAPARPYTPMKGAFSNVWFDRYKICNDCPEHIESIDSMCQGLTDLINDEVKNGIAKNRILIGGFSMGGGMAMHLAFRFHQDLAGVFALSSFLNKDSAVYQALKKNENALPELFQCHGTADDLVLYSWGEETNKMLKSLGVSTSLHTFPNLNHELNRTEIEKLKSWIVKKLPVEAPKANE",
        "proteome": "UP000197619",
        "gene": "LYPLAL1",
        "go_terms": [
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "480047bf4951157f05965ce351dd9692ddf52b46",
        "counters": {
            "domain_architectures": 32952,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 32952
        }
    }
}