HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A218MCD0",
"id": "A0A218MCD0_9GEMI",
"source_organism": {
"taxId": "269277",
"scientificName": "Squash leaf curl Philippines virus",
"fullName": "Squash leaf curl Philippines virus"
},
"name": "Replication-associated protein",
"description": [
"Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities"
],
"length": 160,
"sequence": "MAPPKRFRIQAKNYFLTYPKCSLTKEEALSQLQTLETPTSKKFIKICRELHEDGSPHIHVLIQFEGKFVCTNNRFFDLVSPKFGSAHFHPNIQGAKSSSDVKSYINKDGNTLEWGEFQVDGRSARGGQQSANDTAAKALNSGSAEAALAIIREELPKDFI",
"proteome": null,
"gene": "C1",
"go_terms": [
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016888",
"name": "DNA endonuclease activity, producing 5'-phosphomonoesters",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005198",
"name": "structural molecule activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "3576995e52844acc3074eed64c2fbc93b5358a47",
"counters": {
"domain_architectures": 9115,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 2,
"profile": 1,
"prints": 2,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 9115
}
}
}