"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A218MCD0"	"{'domain_architectures': 9115, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 2, 'profile': 1, 'prints': 2, 'interpro': 4}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 9115}"	"[""Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all geminiviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities""]"	"C1"	"[{'identifier': 'GO:0006260', 'name': 'DNA replication', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016888', 'name': ""DNA endonuclease activity, producing 5'-phosphomonoesters"", 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005198', 'name': 'structural molecule activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A218MCD0_9GEMI"	"3576995e52844acc3074eed64c2fbc93b5358a47"	False	False	True	160	"Replication-associated protein"	3	""	"MAPPKRFRIQAKNYFLTYPKCSLTKEEALSQLQTLETPTSKKFIKICRELHEDGSPHIHVLIQFEGKFVCTNNRFFDLVSPKFGSAHFHPNIQGAKSSSDVKSYINKDGNTLEWGEFQVDGRSARGGQQSANDTAAKALNSGSAEAALAIIREELPKDFI"	"unreviewed"	"{'taxId': '269277', 'scientificName': 'Squash leaf curl Philippines virus', 'fullName': 'Squash leaf curl Philippines virus'}"
