General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1S3AF42",
        "id": "A0A1S3AF42_ERIEU",
        "source_organism": {
            "taxId": "9365",
            "scientificName": "Erinaceus europaeus",
            "fullName": "Erinaceus europaeus (Western European hedgehog)"
        },
        "name": "Nucleoplasmin-3",
        "description": [
            "Plays a role in the regulation of diverse cellular processes such as ribosome biogenesis, chromatin remodeling or protein chaperoning. Modulates the histone chaperone function and the RNA-binding activity of nucleolar phosphoprotein B23/NPM. Efficiently mediates chromatin remodeling when included in a pentamer containing NPM3 and NPM"
        ],
        "length": 182,
        "sequence": "MAAGTAAALPFLSQESRLRAGGVGGLRIPAPVTMDSFFFGCELSGRTRSFTFKVEEEDDAEHMLALTMLCLTEGAKDECNVVEVVARNRDHQEIAVPVANLRLSCQPMLSLDDFQLQPPVTFRLRSGSGPVRITGRHQIVTLSNDISEEDSEEEGSEEEEAKLCPILPAKKQRGRPWPPLVN",
        "proteome": "UP001652624",
        "gene": "NPM3",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7fdd4dd78d076a5e5ddb4d21ac1972685d187714",
        "counters": {
            "domain_architectures": 2573,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2573
        }
    }
}