"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A1S3AF42"	"{'domain_architectures': 2414, 'entries': 7, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2414}"	"['Plays a role in the regulation of diverse cellular processes such as ribosome biogenesis, chromatin remodeling or protein chaperoning. Modulates the histone chaperone function and the RNA-binding activity of nucleolar phosphoprotein B23/NPM. Efficiently mediates chromatin remodeling when included in a pentamer containing NPM3 and NPM']"	"NPM3"	""	"A0A1S3AF42_ERIEU"	"7fdd4dd78d076a5e5ddb4d21ac1972685d187714"	True	False	182	"Nucleoplasmin-3"	3	"UP001652624"	"MAAGTAAALPFLSQESRLRAGGVGGLRIPAPVTMDSFFFGCELSGRTRSFTFKVEEEDDAEHMLALTMLCLTEGAKDECNVVEVVARNRDHQEIAVPVANLRLSCQPMLSLDDFQLQPPVTFRLRSGSGPVRITGRHQIVTLSNDISEEDSEEEGSEEEEAKLCPILPAKKQRGRPWPPLVN"	"unreviewed"	"{'taxId': '9365', 'scientificName': 'Erinaceus europaeus', 'fullName': 'Erinaceus europaeus (Western European hedgehog)'}"