General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1L9MZ75",
        "id": "A0A1L9MZ75_ASPTC",
        "source_organism": {
            "taxId": "767770",
            "scientificName": "Aspergillus tubingensis (strain CBS 134.48)",
            "fullName": "Aspergillus tubingensis (strain CBS 134.48)"
        },
        "name": "EKC/KEOPS complex subunit CGI121",
        "description": [
            "Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. CGI121 acts as an allosteric effector that regulates the t(6)A activity of the complex. The EKC/KEOPS complex also promotes both telomere uncapping and telomere elongation. The complex is required for efficient recruitment of transcriptional coactivators. CGI121 is not required for tRNA modification"
        ],
        "length": 199,
        "sequence": "MSAPLLETIHLSHLPLSMPVHVALYRDVQNAPYLRQQLMSANAEFEYAFIDASTVLSRTHLLSAVFRAVNDYMNGRLKSRNVHSEMVFSLSPATNIAESFRKFGITDSTKDLLVVKLSVTPEITHDSVAAHLGQNVEGTPVPFDDETLSKISDIAKIKKAYKLGALNTTPPNQANGTQDNGMRRLELSVLGAIALRGAT",
        "proteome": "UP000184304",
        "gene": "ASPTUDRAFT_45604",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fd915e41acd5042efaf0afef90965b3303da1187",
        "counters": {
            "domain_architectures": 4696,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4696
        }
    }
}