General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1L8G5S0",
        "id": "A0A1L8G5S0_XENLA",
        "source_organism": {
            "taxId": "8355",
            "scientificName": "Xenopus laevis",
            "fullName": "Xenopus laevis (African clawed frog)"
        },
        "name": "Squalene synthase",
        "description": [
            "Catalyzes the condensation of 2 farnesyl pyrophosphate (FPP) moieties to form squalene. Proceeds in two distinct steps. In the first half-reaction, two molecules of FPP react to form the stable presqualene diphosphate intermediate (PSQPP), with concomitant release of a proton and a molecule of inorganic diphosphate. In the second half-reaction, PSQPP undergoes heterolysis, isomerization, and reduction with NADPH or NADH to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway"
        ],
        "length": 452,
        "sequence": "MASVNCKTAVSLFKRTLSLGPAQKPCGQRSLLTASRLQDRGLKEGRTVQICFAPQSQAVCRVHPVYFLQQDSMSDSLQTCYRYLNETSRSFAAVIQALDGELRHAVCIFYLVLRALDTVEDDMTIALETKTPMLHDFHTYLYQADWRYMDSKEKDKQVLEDFPTISLEFRKLAVIYQEVIADICHKMGVGMAEYLEKKVQTLQEWDQYCHYVAGLVGIGLSRLFSASELEDPIVGLDTQLSNSMGLFLQKTNIIRDYLEDQTEGREFWPKEVWGKYGKKLSDLANPEKIIPAVHCMNELITNALHHVPDVLTYLSRLKNQSVFNFCAIPQVMAIATLAACYNNQQVYKGVVKIRKGQAVTLMMDATNIEAVRAIMYQYVEEIYQKIPLTDPSSGRTQHIIASVRNLSLSDGSLASRNHFSPIYLSCAMLLAAISWQYLSTVSQVSEEVHSRQ",
        "proteome": "UP000186698",
        "gene": "fdft1.S",
        "go_terms": [
            {
                "identifier": "GO:0051996",
                "name": "squalene synthase [NAD(P)H] activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045338",
                "name": "farnesyl diphosphate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008610",
                "name": "lipid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016765",
                "name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7ee50707bedad879bc606a96fc69cbee4c35c950",
        "counters": {
            "domain_architectures": 33932,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "sfld": 2,
                "ncbifam": 1,
                "prosite": 2,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 33932
        }
    }
}