General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1G4IFS9",
        "id": "A0A1G4IFS9_TRYEQ",
        "source_organism": {
            "taxId": "5694",
            "scientificName": "Trypanosoma equiperdum",
            "fullName": "Trypanosoma equiperdum"
        },
        "name": "Deoxyhypusine hydroxylase",
        "description": [
            "Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate produced by deoxyhypusine synthase/DHPS on a critical lysine of the eukaryotic translation initiation factor 5A/eIF-5A. This is the second step of the post-translational modification of that lysine into an unusual amino acid residue named hypusine. Hypusination is unique to mature eIF-5A factor and is essential for its function",
            "Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)-L-lysine intermediate to form hypusine, an essential post-translational modification only found in mature eIF-5A factor"
        ],
        "length": 317,
        "sequence": "MDQDLSVCEQEYRKLLDPEEPLFSRTRELYRLKESILRTPAGVHVLAKAVDTTNSVLLQHELVYNLGQSAMVEACPHLERFIRAVGKYDIVTRHEAVEALGAIGDPACIPLLRHFMEPANEPEAAIRESCELALKRIEMLEEKGKEAVGPAANCPFVSIDPAPAFNGTNIGGSAPYTVSELENLLCDTTGAVSLWLRYQAMFTLRNIGTPEAVAALSRALRQDNTSALLRHEVAFVLGQLEHPASQPALLDALRDEHEAPMVRHEAAEALGAIADPKTLPALEEYAKHKEAIVRDSCVVALEMHKYWSQFNNQRIQH",
        "proteome": "UP000195570",
        "gene": "TEOVI_000282800",
        "go_terms": [
            {
                "identifier": "GO:0019135",
                "name": "deoxyhypusine monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008612",
                "name": "peptidyl-lysine modification to peptidyl-hypusine",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "002112098362c4876aa1cc5573403d54b5b94ca1",
        "counters": {
            "domain_architectures": 63,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "ssf": 1,
                "pfam": 2,
                "profile": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 63
        }
    }
}