HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A1A6HFF6",
"id": "A0A1A6HFF6_NEOLE",
"source_organism": {
"taxId": "56216",
"scientificName": "Neotoma lepida",
"fullName": "Neotoma lepida (Desert woodrat)"
},
"name": "FAS-associated death domain protein",
"description": [
"Apoptotic adapter molecule that recruits caspases CASP8 or CASP10 to the activated FAS/CD95 or TNFRSF1A/TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs CASP8 proteolytic activation. Active CASP8 initiates the subsequent cascade of caspases mediating apoptosis. Involved in interferon-mediated antiviral immune response, playing a role in the positive regulation of interferon signaling"
],
"length": 208,
"sequence": "MDPFLVLLHSLSGSLSNSDLMELKFLCRERVGKRKLERVQSGLDLFSVLLEQNDLERGRTGLLRELLASLRRHDLLQRLDDFEAGTAASAAPGEADLRVAFDIVCDNLGRDWKRLARQLKLSEAKIDGIEERYPRSLSDQVRETLRVWKIAEREKATAAGLVKALRACRLNLVADLVEEALQAQGSVNESDDVSPVLWDPTVSSSEAL",
"proteome": "UP000092124",
"gene": "A6R68_16248",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042981",
"name": "regulation of apoptotic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007165",
"name": "signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f9d417453a13a610dfd4db30c29f560ffa4ad87e",
"counters": {
"domain_architectures": 861,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 2,
"profile": 2,
"pfam": 2,
"cdd": 2,
"pirsf": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 861
}
}
}