GET /api/protein/UniProt/A0A1A6HFF6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A1A6HFF6",
        "id": "A0A1A6HFF6_NEOLE",
        "source_organism": {
            "taxId": "56216",
            "scientificName": "Neotoma lepida",
            "fullName": "Neotoma lepida (Desert woodrat)"
        },
        "name": "FAS-associated death domain protein",
        "description": [
            "Apoptotic adapter molecule that recruits caspases CASP8 or CASP10 to the activated FAS/CD95 or TNFRSF1A/TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs CASP8 proteolytic activation. Active CASP8 initiates the subsequent cascade of caspases mediating apoptosis. Involved in interferon-mediated antiviral immune response, playing a role in the positive regulation of interferon signaling"
        ],
        "length": 208,
        "sequence": "MDPFLVLLHSLSGSLSNSDLMELKFLCRERVGKRKLERVQSGLDLFSVLLEQNDLERGRTGLLRELLASLRRHDLLQRLDDFEAGTAASAAPGEADLRVAFDIVCDNLGRDWKRLARQLKLSEAKIDGIEERYPRSLSDQVRETLRVWKIAEREKATAAGLVKALRACRLNLVADLVEEALQAQGSVNESDDVSPVLWDPTVSSSEAL",
        "proteome": "UP000092124",
        "gene": "A6R68_16248",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042981",
                "name": "regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0007165",
                "name": "signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f9d417453a13a610dfd4db30c29f560ffa4ad87e",
        "counters": {
            "domain_architectures": 861,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 2,
                "profile": 2,
                "pfam": 2,
                "cdd": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 861
        }
    }
}