General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A182QLP1",
        "id": "A0A182QLP1_9DIPT",
        "source_organism": {
            "taxId": "69004",
            "scientificName": "Anopheles farauti",
            "fullName": "Anopheles farauti"
        },
        "name": "Transcription initiation factor IIA subunit 2",
        "description": [
            "TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation"
        ],
        "length": 112,
        "sequence": "MSYQLYRNTTLGNTLQESLDELIQYGQITPQLAVRVLVQFDKSINAALSNRVKSRVTFKAAKLNTYRFCDNVWTLMLNDVEFREVHEFARVDKVKIVACDGKNVSTGDDQIR",
        "proteome": "UP000075886",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0006367",
                "name": "transcription initiation at RNA polymerase II promoter",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005672",
                "name": "transcription factor TFIIA complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "129e83f6b2f9b7f8f58ced155fef04f6239df37d",
        "counters": {
            "domain_architectures": 4124,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cdd": 2,
                "cathgene3d": 2,
                "ssf": 2,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4124
        }
    }
}