"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A182QLP1"	"{'domain_architectures': 4124, 'entries': 15, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 2, 'cdd': 2, 'cathgene3d': 2, 'ssf': 2, 'pirsf': 1, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4124}"	"['TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation']"	""	"[{'identifier': 'GO:0006367', 'name': 'transcription initiation at RNA polymerase II promoter', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005672', 'name': 'transcription factor TFIIA complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"A0A182QLP1_9DIPT"	"129e83f6b2f9b7f8f58ced155fef04f6239df37d"	True	False	False	112	"Transcription initiation factor IIA subunit 2"	3	"UP000075886"	"MSYQLYRNTTLGNTLQESLDELIQYGQITPQLAVRVLVQFDKSINAALSNRVKSRVTFKAAKLNTYRFCDNVWTLMLNDVEFREVHEFARVDKVKIVACDGKNVSTGDDQIR"	"unreviewed"	"{'taxId': '69004', 'scientificName': 'Anopheles farauti', 'fullName': 'Anopheles farauti'}"