General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A173GA79",
        "id": "A0A173GA79_9CAUD",
        "source_organism": {
            "taxId": "1837867",
            "scientificName": "Escherichia phage UFV-AREG1",
            "fullName": "Escherichia phage UFV-AREG1"
        },
        "name": "Antiholin",
        "description": [
            "Involved in lysis inhibition. Senses superinfections and inhibits the holin, thereby delaying the host cell lysis timing. The genomic DNA from the superinfecting phage bound to the complex holin-antiholin probably serves as a signal for the lysis inhibition and blocks the holin multimerization"
        ],
        "length": 97,
        "sequence": "MALKATALFAMLGLSFVLSPSIEANVDPHFDKFMESGIRHVYTLFENKSVESSEQFYSFMRTTYKNDPCSSDFECIERGAEMAQSYARIMNIKLETE",
        "proteome": "UP000201064",
        "gene": "rI",
        "go_terms": [
            {
                "identifier": "GO:0140678",
                "name": "molecular function inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "59be2b1500829d5c2ffa326f97207c15b3487bac",
        "counters": {
            "domain_architectures": 294,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 294
        }
    }
}