"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"A0A173GA79"	"{'domain_architectures': 190, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'hamap': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 190}"	"['Involved in lysis inhibition. Senses superinfections and inhibits the holin, thereby delaying the host cell lysis timing. The genomic DNA from the superinfecting phage bound to the complex holin-antiholin probably serves as a signal for the lysis inhibition and blocks the holin multimerization']"	"rI"	"[{'identifier': 'GO:0140678', 'name': 'molecular function inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"A0A173GA79_9CAUD"	"59be2b1500829d5c2ffa326f97207c15b3487bac"	False	False	97	"Antiholin"	3	"UP000201064"	"MALKATALFAMLGLSFVLSPSIEANVDPHFDKFMESGIRHVYTLFENKSVESSEQFYSFMRTTYKNDPCSSDFECIERGAEMAQSYARIMNIKLETE"	"unreviewed"	"{'taxId': '1837867', 'scientificName': 'Escherichia phage UFV-AREG1', 'fullName': 'Escherichia phage UFV-AREG1'}"
