General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A151MEB7",
        "id": "A0A151MEB7_ALLMI",
        "source_organism": {
            "taxId": "8496",
            "scientificName": "Alligator mississippiensis",
            "fullName": "Alligator mississippiensis (American alligator)"
        },
        "name": "Methyltransferase HEMK2",
        "description": [
            "Methyltransferase that can methylate proteins and, to a lower extent, arsenic. Catalytic subunit of a heterodimer with TRMT112, which monomethylates 'Lys-12' of histone H4 (H4K12me1), a modification present at the promoters of numerous genes encoding cell cycle regulators. Catalytic subunit of a heterodimer with TRMT112, which catalyzes N5-methylation of Glu residue of proteins with a Gly-Gln-Xaa-Xaa-Xaa-Arg motif. Methylates ETF1 on 'Gln-185'; ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May also play a role in the modulation of arsenic-induced toxicity by mediating the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid. It however only plays a limited role in arsenic metabolism compared with AS3MT"
        ],
        "length": 217,
        "sequence": "MAAPALPTPQHHHVGPRGPFCEVYEPAEDTYLLLDALELDAAQLRNARVEICLEVGSGSGVVSTFLASIVGPKALYICTDINPTAAFCTMETALLNKVHIQPIITDLVTGLVPRLNGQVDVLLFNPPYVVTPPEEAESHGIEAAWAGGKNGREVMDRLFPLVADLLSTGGLFYLVTIKENNPDEILEIMKQCGLRGAKVLSRRAGKEMLTILKFSKS",
        "proteome": "UP000050525",
        "gene": "N6AMT1",
        "go_terms": [
            {
                "identifier": "GO:0008168",
                "name": "methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0032259",
                "name": "methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0d8b878601c6bceffbd1ea258abe6a468799d091",
        "counters": {
            "domain_architectures": 46530,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 46530
        }
    }
}