GET /api/protein/UniProt/A0A0S2SQD2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A0S2SQD2",
"id": "A0A0S2SQD2_9VIRU",
"source_organism": {
"taxId": "12235",
"scientificName": "Cucumber green mottle mosaic virus",
"fullName": "Cucumber green mottle mosaic virus"
},
"name": "Capsid protein",
"description": [
"Capsid protein self-assembles to form rod-shaped virions about 18 nm in diameter with a central canal enclosing the viral genomic RNA"
],
"length": 161,
"sequence": "MAYNPITPSKLIAFSASYVPVRTLLNFLVASQGTAFQTQAGRDSFRESLSALPSSVVDINSRFPDAGFYAFLNGPVLRPIFVSLLSSTDTRNRVIEVVDPSNPTTAESLNAVKRTDDASTAARAEIDNLIESISKGFDVYDRASFEAAFSVVWSEATTSKA",
"proteome": null,
"gene": "CP",
"go_terms": [
{
"identifier": "GO:0005198",
"name": "structural molecule activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019028",
"name": "viral capsid",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "f7e9d877d5b2963f5991f584a79c6fad9c277821",
"counters": {
"domain_architectures": 1434,
"entries": 5,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1434
}
}
}